If you have been reading about certificate of analysis and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2026-03-31. Numbers and descriptions here follow the published literature rather than marketing material.
Published animal and early human work describes growth hormone release that is separated from comparable rises in adrenocorticotropic hormone and cortisol. Prolactin changes are reported as small in the same studies. Selectivity is attributed to binding at the ghrelin receptor and to the downstream signaling that follows, rather than to differences in how quickly the peptide is cleared. Authors commonly label the compound selective rather than potent, because the same mass produces a smaller growth hormone response than some older secretagogues tested in parallel. Whether that profile holds across species and routes of administration remains an open question.
Human data remain limited and come mainly from small, short-term studies conducted decades ago. The peptide has not received approval as a medicine from major regulators, so current availability is largely as a research chemical. Reported effects on growth hormone pulsatility, appetite, and body composition should be read as preliminary, since few independent groups have replicated the original findings. Analytical characterization of research-grade material varies between suppliers, which complicates comparison across studies. Regulatory status also differs by country, and some jurisdictions classify it as a prescription-only or otherwise restricted item.
Ipamorelin is a synthetic pentapeptide that belongs to the growth hormone secretagogue class. It acts as an agonist at the ghrelin receptor, also called the growth hormone secretagogue receptor type 1a. The compound was designed in the 1990s during a search for agents that release growth hormone with fewer off-target hormonal effects than earlier secretagogues. It appears in the research literature under several sequence-based names. Material supplied for laboratory work is normally a lyophilized solid, and it is not marketed as an approved therapeutic in major jurisdictions.
Analytical confirmation relies on reversed-phase high-performance liquid chromatography, often coupled to mass spectrometry for identity and purity assessment. Mass spectrometry distinguishes the intact molecule from truncation products and from oxidation or deamidation variants that share similar chromatographic retention. Immunoassays appear in some biological studies but can cross-react with related peptides, so they are weaker tools for identity work. Reported purity figures depend heavily on the gradient, detector, and integration method used, which complicates direct comparison between laboratories.
Research quantities of ipamorelin are typically distributed as a white to off-white lyophilized powder. The solid dissolves readily in water and in aqueous buffers, and stock solutions are commonly prepared in sterile water or a mildly acidic diluent. Adsorption to plastic and glass surfaces can reduce the concentration of very dilute solutions, so containers and transfer steps deserve attention when accurate concentrations matter. Reconstituted material is generally used promptly rather than held for extended periods.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C38H49N9O5 | Value for the free base |
| Molar mass | 711.9 g/mol | Calculated from the formula |
| Appearance | White to off-white powder | Typical lyophilized form |
| Mechanism class | Ghrelin receptor agonist | Also described as a secretagogue |
| Half-life | About 2 hours | Reported for human circulation |
The lyophilised solid is normally held at -20 °C or colder, shielded from light and moisture. Stability in that state is measured in years, although shelf life depends on residual water content and the container seal. Once dissolved, the peptide is more fragile: aqueous solutions are commonly kept at 2-8 °C and used within days to weeks, and repeated freeze-thaw cycling is avoided. Strongly acidic or basic conditions accelerate hydrolysis, and prolonged exposure to them can strip the terminal amide.
Purity assessment for this peptide relies mainly on reversed-phase high-performance liquid chromatography. A C18 column with a water-acetonitrile gradient containing trifluoroacetic acid separates the target from truncated sequences and oxidation products. Detection near 214 nm exploits the amide backbone, while the aromatic side chains allow additional monitoring close to 280 nm. Reported purity values depend on the method, so a certificate of analysis carries weight only when gradient, column and integration parameters are given.
The citric acid cycle is regulated mainly by the availability of key substrates, particularly the ratio of NAD+ to NADH and the concentrations of calcium, inorganic phosphate, ATP, ADP, and AMP. Citrate – the ion that gives its name to the cycle – is a feedback inhibitor of citrate synthase and also inhibits PFK, providing a direct link between the regulation of the citric acid cycle and glycolysis.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Immunofluorescence imaging in the human U2OS cell line (bone Osteosarcoma epithelial cells) shows localization in the cytosol. Immunohistochemistry imaging of human prostate tissue also suggests cytosolic localization. A bipartite nuclear localization signal is predicted at position 128 – 143, which is highly conserved in mammalian orthologs (see Fig.2.), indicating possible localization in the nucleus. The predicted promoter sequence for this gene spans from base pair 37196852 to 37198126 (1,275 bp) and has multiple predicted binding sites for transcription factors such as GATA binding factors, SMAD3, TP63 and NRF1. MIPOL1 is ubiquitously expressed at low levels in humans, with highest expression in the prostate. The RNA secondary structure is stabilized by multiple stem loops that have been predicted (using bioinformatics tools), and conserved across closely related species. Multiple binding targets are found for microRNAs such as MIR3163 and MIR190a, that could silence these regions on the mRNA and inhibit translation.
The American Society for Biochemistry and Molecular Biology publishes three research journals and a monthly magazine covering society news and activity updates. ASBMB journals are peer-reviewed and cover research in the fields of microbiology, molecular genetics, RNA-related research, proteomics, genomics, transcription, peptides, cell signaling, lipidomics, and systems biology. All articles are published online as "Papers in Press" upon acceptance. As of January 2021, all three ASBMB journals are fully open access.
Animals ingest amino acids in the form of protein. The protein is broken down into its constituent amino acids in the process of digestion. The amino acids are then used to synthesize new proteins and other nitrogenous biomolecules, or they are further catabolized through oxidation to provide a source of energy. The oxidation pathway starts with the removal of the amino group by a transaminase; the amino group is then fed into the urea cycle. The other product of transamidation is a keto acid that enters the citric acid cycle. Glucogenic amino acids can also be converted into glucose, through gluconeogenesis. Of the 20 standard amino acids, nine (His, Ile, Leu, Lys, Met, Phe, Thr, Trp and Val) are called essential amino acids because the human body cannot synthesize them from other compounds at the level needed for normal growth, so they must be obtained from food.
Sources: en.wikipedia.org
On-line mass spectrometry was develop to solve some of the limitations and problem that develop from off-line analysis, such as evaporation and chemical reactions of particles in the filters during long analysis time. On-line Mass spectrometry solves these problems through the collection and analysis of aerosol particles in real time. On-line instruments are very portable and allow for spatial variability to be examined. These portable instruments can be put on many different platforms such as boats, planes, and mobile platforms (e.g. car trailers). An example of this is in the picture at the beginning with the instrumentation attached to an aircraft. Like off-line, on-line mass spectrometry has many different type of instruments, which can be broken up into two types; instruments that measures the chemistry of the particle ensemble (bulk measurement) and those that measure the chemistry of individual particles (single-particle measurement). Thus based on analytical need different instrumentation is used in analysis of the aerosol particles.
Chromosome 11 open reading frame 91, or C11orf91 is a protein which in humans is encoded by the C11orf91 gene. The C11orf91 gene consists of 5159 nucleotides with an mRNA of approximately 836 base pairs. There is one exon found in the C11orf91 gene. The cytogenetic band location of C11orf91 is 11p13 and is located on the minus strand of the DNA . Annotated depiction of the C11orf91 mRNA and amino acid protein sequences. The C11orf91 gene encodes a protein that is 193 amino acids in length. The C11orf91 protein contains a domain of unknown function, DUF5529, that spans nearly the entire protein. RBMX protein binding sites were found to be highly conserved in several structures of human C11orf91 3'UTR and 5' UTR. C11orf91 is rich in serine and proline and poor in valine and asparagine. There is a proline rich region found in the middle of the C11orf91. The human C11orf91 protein is approximately 20 kDal and has an isoelectric point around 9. Human C11orf91 protein is predicted to be localized in vesicles. C11orf91 has two helices located near the C-terminus and no beta sheets.
Klibanski became chief of the Neuroendocrine Unit at Massachusetts General Hospital, studying hormones and neuroendocrinology with a focus on hypopituitarism and pituitary tumors. Her clinical research has also examined the effects of hypothalamic and pituitary disorders on body composition and bone density, including bone loss associated with anorexia nervosa and growth hormone deficiency. In 1997, Klibanski became the first woman from Mass General's Department of Medicine to become a professor of medicine at Harvard. She has authored more than 350 peer-reviewed papers and book chapters and has received the Endocrine Society Clinical Investigator Award and the Clinical Endocrinology Trust Medal from the Society for Endocrinology. Klibanski has served on the National Institute of Diabetes and Digestive and Kidney Diseases Board of Counselors and the editorial board of the Journal of Clinical Endocrinology and Metabolism, and is a past president of the Pituitary Society. She established the Center for Faculty Development at Massachusetts General Hospital and mentored more than fifty women, for which she received the Endocrine Society's Outstanding Mentor Award.
AAA proteases use the energy from ATP hydrolysis to translocate a protein inside the proteasome for degradation. Cdc48p/p97 functions as a hexameric AAA+ ATPase that provides the mechanical force necessary for substrate dislocation. Its activity is tightly regulated by ATP binding and hydrolysis, which induce conformational changes required for protein unfolding and extraction. The HbYX motif plays a crucial role in regulating this process by mediating interactions between Cdc48p/p97 and downstream effectors such as the 20S proteasome or specific cofactors (e.g., Ufd1/Npl4). This interaction facilitates substrate transfer from Cdc48p/p97 to the proteasome, ensuring efficient protein degradation. Given its pivotal role in protein homeostasis, Cdc48p/p97 has been implicated in a wide range of cellular processes beyond ERAD, including autophagy, mitochondrial quality control, and DNA repair. The dysregulation of its function, particularly through mutations affecting the ATPase domain or HbYX-mediated interactions, has been linked to neurodegenerative diseases and cancer.
Angiotensin-converting-enzyme inhibitors (ACE inhibitors) are a class of medication used primarily for the treatment of cardiovascular and kidney diseases. This class of medicine works by causing relaxation of blood vessels as well as a decrease in blood volume, which leads to lower blood pressure and decreased oxygen demand from the heart. ACE inhibitors inhibit the activity of angiotensin-converting enzyme, an important component of the renin–angiotensin system which converts angiotensin I to angiotensin II, and hydrolyzes bradykinin. Therefore, ACE inhibitors decrease the formation of angiotensin II, a vasoconstrictor, and increase the level of bradykinin, a peptide vasodilator. This combination is synergistic in lowering blood pressure. As a result of inhibiting the ACE enzyme in the bradykinin system, the ACE inhibitor drugs allow for increased levels of bradykinin which would normally be degraded. Bradykinin produces prostaglandin. This mechanism can explain the two most common side effects seen with ACE Inhibitors: angioedema and cough.
Sources: en.wikipedia.org
c7orf26 (accession: NM_024067 / NP_076972; alias: MGC-2178) is located on the long arm of chromosome 7 (7p22.1), starting at 6590021 and ending at 6608726. The c7orf26 gene spans 2178 base pairs and is orientated on the + strand. The coding region is made up of a protein sequence measuring 449 amino acids long. It is divided into 6 transcripts containing a total of 24 exons on the forward strand and has 5952 unique Single Nucleotide Polymorphisms (SNPs). Genes ZDHHC4, ZNF853 and ZNF316 neighbor c7orf26 on chromosome 7. Gene ZDHHC4 is a zinc-finger protein involved with cytochrome-c oxidase activity and protein-cysteine S-palmitoyltransferase activity and has overlapping regions with c7orf26. Gene GRID2IP lies upstream by >2000 bp of c7orf26, and is heavily involved with in synaptogenesis and synaptic plasticity. c7orf26 is highly expressed in lymphatic, reproductive, and nervous tissue. These include the brain (frontal and occipital cortex), thymus glands, salivary glands, endometrium, cervix, and prostate. It is intermediately expressed in the lungs.
In both pharmacology and nutrition sciences, bioavailability is measured by calculating the area under curve (AUC) of the drug concentration time profile. Bioavailability is a term used to describe the percentage of an administered dose of a xenobiotic that reaches the systemic circulation unchanged. It is denoted by the letter f (or, if expressed in percent, by F). In nutritional science, which covers the intake of nutrients and non-drug dietary ingredients, the concept of bioavailability lacks the well-defined standards associated with the pharmaceutical industry. The pharmacological definition cannot apply to these substances because utilization and absorption is a function of the nutritional status and physiological state of the subject, resulting in even greater differences from individual to individual (inter-individual variation). Therefore, bioavailability for dietary supplements can be defined as the proportion of the administered substance capable of being absorbed and available for use or storage.
In some neurodegenerative diseases, alpha-synuclein produces insoluble inclusion bodies. These diseases, known as synucleinopathies, are connected with either higher levels of normal alpha-synuclein or its mutant variants. The normal physiological role of Snca, however, has not yet been thoroughly explained. In fact, physiological Snca has been demonstrated to have a neuroprotective impact by inhibiting apoptosis induced by several types of apoptotic stimuli, or by regulating the expression of proteins involved in apoptotic pathways. Recently it has been demonstrated that up-regulation of alpha-synuclein in the dentate gyrus (a neurogenic niche where new neurons are generated throughout life) activates stem cells, in a model of premature neural aging. This model shows reduced expression of alpha-synuclein and reduced proliferation of stem cells, as is physiologically observed during aging. Exogenous alpha-synuclein in the dentate gyrus is able to rescue this defect. Moreover, alpha-synuclein also boosts the proliferation of dentate gyrus progenitor neural cells in wild-type young mice. Thus, alpha-synuclein represents an effector for neural stem and progenitor cell activation. Similarly, alpha-synuclein has been found to be required to maintain stem cells of the subventricular zone another neurogenic niche, in a cycling state.
Preparing TNP-ATP is a one-step synthesis that is relatively safe and easy. Adenosine's ribose moiety can be trinitrophenylated by 2,4,6-trinitrobenzene-1-sulfonate (TNBS). The resulting compound assumes a bright orange color and has visible absorption characteristics, as is characteristic of a Meiseinheimer spiro complex compound linking. To see the exact method of preparion, please refer to T. Hiratsuka's and K. Uchida's paper "Preparation and Properties of 2'(r 3')-O(2,4,6-trinitrophenyl) Adenosine 5'-triphosphate, an Analog of Adenosine Triphosphate," found in the reference section. To revert TNP-ATP back to its constituent parts, or in other words to hydrolyze TNP-ATP to give equilmolar amounts of picric acid (TNP) and ATP, TNP-ATP should be treated with 1 M HCl at 100 degrees Celsius for 1.5 hours. This is because if TNP-ATP is acidified under mild conditions, it results in the opening of the dioxolane ring attached to the 2’-oxygen, leaving a 3’O-TNP derivative as the only product.
The post-bioprinting process is necessary to create a stable structure from the biological material. If this process is not well-maintained, the mechanical integrity and function of the 3D printed object is at risk. To maintain the object, both mechanical and chemical stimulations are needed. These stimulations send signals to the cells to control the remodeling and growth of tissues. In addition, in recent development, bioreactor technologies have allowed the rapid maturation of tissues, vascularization of tissues and the ability to survive transplants. Bioreactors work in either providing convective nutrient transport, creating microgravity environments, changing the pressure causing solution to flow through the cells, or adding compression for dynamic or static loading. Each type of bioreactor is ideal for different types of tissue, for example compression bioreactors are ideal for cartilage tissue.
Sources: en.wikipedia.org
It has not been approved as a therapeutic by major regulators, and the human trial record is small and dated. Material available today is mostly sold as a research chemical for laboratory use. Approval and restriction status varies by country.
It binds the ghrelin receptor, known as the growth hormone secretagogue receptor type 1a. Activation of that receptor triggers signaling that leads to growth hormone release. Selectivity for growth hormone over cortisol and prolactin is the property most often cited for this compound.
Published estimates place the circulating half-life at roughly two hours in humans. Clearance involves peptidase activity and renal handling. Because the peptide is short-lived, release patterns after administration are usually described as pulsatile rather than sustained.
Typical guidance is -20 °C in a sealed container with desiccant and protection from light. The powder tolerates handling better than a solution, but repeated warming and cooling is still avoided.